PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_19513_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 310aa    MW: 35104.7 Da    PI: 7.5688
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_19513_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-15249148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g+W+++Ed++l+ +++++G g+W+  + + g+ R++k+c++rw +yl
  cra_locus_19513_iso_1_len_1035_ver_3  2 KGPWSADEDLKLLSYIQKHGHGSWRHLPPKAGLQRCGKSCRLRWTNYL 49
                                          79********************************************97 PP

2Myb_DNA-binding54.62.4e-1755100148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           rg+++ +E++ +++++++lG++ W+tIa++++ +Rt++++k++w+++l
  cra_locus_19513_iso_1_len_1035_ver_3  55 RGNFSLQEEQTIIQLHALLGNR-WSTIANHLP-RRTDNEIKNYWNTHL 100
                                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.5E-11151IPR001005SANT/Myb domain
PROSITE profilePS5129416.263149IPR017930Myb domain
PfamPF002492.0E-14249IPR001005SANT/Myb domain
SuperFamilySSF466891.67E-28296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-22356IPR009057Homeodomain-like
CDDcd001679.40E-10449No hitNo description
PROSITE profilePS5129426.13350104IPR017930Myb domain
SMARTSM007172.0E-1654102IPR001005SANT/Myb domain
PfamPF002497.0E-1655100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2657104IPR009057Homeodomain-like
CDDcd001678.47E-1257100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
XKGPWSADED LKLLSYIQKH GHGSWRHLPP KAGLQRCGKS CRLRWTNYLR PDIKRGNFSL  60
QEEQTIIQLH ALLGNRWSTI ANHLPRRTDN EIKNYWNTHL KKRLTKMGID PMTHKPKANV  120
LIIGSSDDQS KDISNLNHMA QWEIARLEAE ARLVREAKFV IPNPINSLSK DSLLALPPLN  180
KQQPMVSPCL DILKASERSS WADINLNFNV GTLLSPNSVL MPPFPDNMNF ITASASVSPR  240
LDNYAQKGNE VEGTIEMQEI MGSFSDQVDF GDQSFSLGIP NGRLMEFPDE FLLSDNCCGG  300
GYLEDNKYWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2521047108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316122.14e-96hypothetical protein POPTR_0010s17300g
TrEMBLK7ZBK14e-97K7ZBK1_9ASPA; R2R3-MYB transcription factor
STRINGPOPTR_0010s17300.11e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154